NFE2L1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14753T
Artikelname: NFE2L1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14753T
Hersteller Artikelnummer: CNA14753T
Alternativnummer: MBL-CNA14753T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 515-772 of human NFE2L1 (NP_003195.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 4779
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSKFCRMSYQDPAQLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIPFTNDKIINLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPK
Target-Kategorie: NFE2L1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200