ORC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14756T
Artikelname: ORC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14756T
Hersteller Artikelnummer: CNA14756T
Alternativnummer: MBL-CNA14756T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 696-856 of human ORC1 (NP_001177748.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 4998
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE
Target-Kategorie: ORC1
Application Verdünnung: WB: WB,1:500 - 1:2000