S100A5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14779T
Artikelname: S100A5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14779T
Hersteller Artikelnummer: CNA14779T
Alternativnummer: MBL-CNA14779T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A5 (NP_002953.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 6276
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Target-Kategorie: S100A5
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200