[KO Validated] MAP2K4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14781S
Artikelname: [KO Validated] MAP2K4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14781S
Hersteller Artikelnummer: CNA14781S
Alternativnummer: MBL-CNA14781S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human MAP2K4 (NP_003001.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 6416
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
Target-Kategorie: MAP2K4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100