SRD5A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14787T
Artikelname: SRD5A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14787T
Hersteller Artikelnummer: CNA14787T
Alternativnummer: MBL-CNA14787T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRD5A1 (NP_001038.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 6715
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF
Target-Kategorie: SRD5A1
Application Verdünnung: WB: WB,1:500 - 1:2000