ZNF177 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14803T
Artikelname: ZNF177 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14803T
Hersteller Artikelnummer: CNA14803T
Alternativnummer: MBL-CNA14803T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-110 of human ZNF177 (NP_003442.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 7730
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGI
Target-Kategorie: ZNF177
Application Verdünnung: WB: WB,1:500 - 1:2000