FSHR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1480T
Artikelname: FSHR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1480T
Hersteller Artikelnummer: CNA1480T
Alternativnummer: MBL-CNA1480T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 631-695 of human FSHR (NP_000136.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 78kDa
NCBI: 2492
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
Target-Kategorie: FSHR
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200