WISP3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14812T
Artikelname: WISP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14812T
Hersteller Artikelnummer: CNA14812T
Alternativnummer: MBL-CNA14812T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-260 of human WISP3 (NP_937882.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 8838
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGMGISNRVTNENSNCEMRK
Target-Kategorie: CCN6
Application Verdünnung: WB: WB,1:500 - 1:2000