FAM127A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14816T
Artikelname: FAM127A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14816T
Hersteller Artikelnummer: CNA14816T
Alternativnummer: MBL-CNA14816T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human FAM127A (NP_001071639.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 8933
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF
Target-Kategorie: RTL8C
Application Verdünnung: WB: WB,1:500 - 1:2000