LPAR2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14819T
Artikelname: LPAR2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14819T
Hersteller Artikelnummer: CNA14819T
Alternativnummer: MBL-CNA14819T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LPAR2 (NP_004711.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 9170
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDST
Target-Kategorie: LPAR2
Application Verdünnung: WB: WB,1:500 - 1:2000