SLC4A8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14825T
Artikelname: SLC4A8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14825T
Hersteller Artikelnummer: CNA14825T
Alternativnummer: MBL-CNA14825T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC4A8 (NP_001035049.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 123kDa
NCBI: 9498
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL
Target-Kategorie: SLC4A8
Application Verdünnung: WB: WB,1:500 - 1:2000