G3BP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14836P
Artikelname: G3BP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14836P
Hersteller Artikelnummer: CNA14836P
Alternativnummer: MBL-CNA14836P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 131-330 of human G3BP1 (NP_938405.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 10146
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEP
Target-Kategorie: G3BP1
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100