SIGMAR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14837T
Artikelname: SIGMAR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14837T
Hersteller Artikelnummer: CNA14837T
Alternativnummer: MBL-CNA14837T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-80 of human SIGMAR1 (NP_005857.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 10280
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQ
Target-Kategorie: SIGMAR1
Application Verdünnung: WB: WB,1:500 - 1:2000