EBP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14845T
Artikelname: EBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14845T
Hersteller Artikelnummer: CNA14845T
Alternativnummer: MBL-CNA14845T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EBP (NP_006570.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 10682
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SGRAAVVPLGTWRRLSLCWFAVCGFIHLVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITACLWGPLSLWVVIAFLRQHPLRFIL
Target-Kategorie: EBP
Application Verdünnung: WB: WB,1:500 - 1:2000