TCERG1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14850T
Artikelname: TCERG1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14850T
Hersteller Artikelnummer: CNA14850T
Alternativnummer: MBL-CNA14850T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human TCERG1 (NP_006697.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 124kDa
NCBI: 10915
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKA
Target-Kategorie: TCERG1
Application Verdünnung: WB: WB,1:500 - 1:2000