BRMS1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14865T
Artikelname: BRMS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14865T
Hersteller Artikelnummer: CNA14865T
Alternativnummer: MBL-CNA14865T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-210 of human BRMS1 (NP_056214.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 25855
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG
Target-Kategorie: BRMS1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200