ATRNL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14868T
Artikelname: ATRNL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14868T
Hersteller Artikelnummer: CNA14868T
Alternativnummer: MBL-CNA14868T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 53-160 of human ATRNL1 (NP_001263211.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 153kDa
NCBI: 26033
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLI
Target-Kategorie: ATRNL1
Application Verdünnung: WB: WB,1:500 - 1:2000