[KO Validated] Peroxiredoxin 4 (PRDX4) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1486S
Artikelname: [KO Validated] Peroxiredoxin 4 (PRDX4) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1486S
Hersteller Artikelnummer: CNA1486S
Alternativnummer: MBL-CNA1486S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 38-271 of human Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)) (NP_006397.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 10549
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Target-Kategorie: PRDX4
Application Verdünnung: WB: WB,1:500 - 1:2000