CYTH4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14875T
Artikelname: CYTH4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14875T
Hersteller Artikelnummer: CNA14875T
Alternativnummer: MBL-CNA14875T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human CYTH4 (NP_037517.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 27128
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRK
Target-Kategorie: CYTH4
Application Verdünnung: WB: WB,1:500 - 1:2000