DEXI Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14879T
Artikelname: DEXI Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14879T
Hersteller Artikelnummer: CNA14879T
Alternativnummer: MBL-CNA14879T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DEXI (NP_054734.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 28955
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
Target-Kategorie: DEXI
Application Verdünnung: WB: WB,1:500 - 1:2000