ZNF259 Rabbit mAb, Clone: [ARC2563], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA1487S
Artikelname: ZNF259 Rabbit mAb, Clone: [ARC2563], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA1487S
Hersteller Artikelnummer: CNA1487S
Alternativnummer: MBL-CNA1487S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 360-459 of human ZNF259 (O75312).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2563]
Molekulargewicht: 51kDa
NCBI: 8882
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR
Target-Kategorie: ZPR1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200