ZNF248 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14915T
Artikelname: ZNF248 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14915T
Hersteller Artikelnummer: CNA14915T
Alternativnummer: MBL-CNA14915T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ZNF248 (NP_066383.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 57209
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MNKSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSNLVSVGYCITKPEVIFKIEQGEEPWILEKGFPSQCHPERKWKVDDVLESSQENEDDHFWELLFHNNKT
Target-Kategorie: ZNF248
Application Verdünnung: WB: WB,1:500 - 1:2000