OXCT2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14920T
Artikelname: OXCT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14920T
Hersteller Artikelnummer: CNA14920T
Alternativnummer: MBL-CNA14920T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 64064
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLR
Target-Kategorie: OXCT2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200