NTPCR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14944T
Artikelname: NTPCR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14944T
Hersteller Artikelnummer: CNA14944T
Alternativnummer: MBL-CNA14944T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 84284
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Target-Kategorie: NTPCR
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200