ORMDL3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14951T
Artikelname: ORMDL3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14951T
Hersteller Artikelnummer: CNA14951T
Alternativnummer: MBL-CNA14951T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORMDL3 (NP_644809.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 94103
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK
Target-Kategorie: ORMDL3
Application Verdünnung: WB: WB,1:500 - 1:2000