DNAJC19 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14961S
Artikelname: DNAJC19 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14961S
Hersteller Artikelnummer: CNA14961S
Alternativnummer: MBL-CNA14961S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 131118
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Target-Kategorie: DNAJC19
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200