DPPA2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14966T
Artikelname: DPPA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14966T
Hersteller Artikelnummer: CNA14966T
Alternativnummer: MBL-CNA14966T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DPPA2 (NP_620170.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 151871
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPK
Target-Kategorie: DPPA2
Application Verdünnung: WB: WB,1:500 - 1:2000