STAT2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14995P
Artikelname: STAT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14995P
Hersteller Artikelnummer: CNA14995P
Alternativnummer: MBL-CNA14995P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 98kDa
NCBI: 6773
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL
Target-Kategorie: STAT2
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200