LTB4R Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15042T
Artikelname: LTB4R Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15042T
Hersteller Artikelnummer: CNA15042T
Alternativnummer: MBL-CNA15042T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-352 of human LTB4R (NP_001137391.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 1241
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Target-Kategorie: LTB4R
Application Verdünnung: WB: WB,1:500 - 1:1000