OXT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15296T
Artikelname: OXT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15296T
Hersteller Artikelnummer: CNA15296T
Alternativnummer: MBL-CNA15296T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human OXT (NP_000906.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 5020
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Target-Kategorie: OXT
Application Verdünnung: WB: WB,1:200 - 1:2000