PKNOX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15301T
Artikelname: PKNOX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15301T
Hersteller Artikelnummer: CNA15301T
Alternativnummer: MBL-CNA15301T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 322-436 of human PKNOX1 (NP_004562.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 5316
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALAPAHISGLVLENSDSLQ
Target-Kategorie: PKNOX1
Application Verdünnung: WB: WB,1:200 - 1:2000