PCYT2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15309T
Artikelname: PCYT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15309T
Hersteller Artikelnummer: CNA15309T
Alternativnummer: MBL-CNA15309T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-389 of human PCYT2 (NP_002852.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 5833
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQE
Target-Kategorie: PCYT2
Application Verdünnung: WB: WB,1:200 - 1:2000