RABGGTB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15310T
Artikelname: RABGGTB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15310T
Hersteller Artikelnummer: CNA15310T
Alternativnummer: MBL-CNA15310T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human RABGGTB (NP_004573.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 5876
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGR
Target-Kategorie: RABGGTB
Application Verdünnung: WB: WB,1:200 - 1:2000