MPDZ Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15344T
Artikelname: MPDZ Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15344T
Hersteller Artikelnummer: CNA15344T
Alternativnummer: MBL-CNA15344T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1100-1380 of human MPDZ (NP_003820.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 222kDa
NCBI: 8777
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLTGELHMIEL
Target-Kategorie: MPDZ
Application Verdünnung: WB: WB,1:200 - 1:2000