CLIC3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15347T
Artikelname: CLIC3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15347T
Hersteller Artikelnummer: CNA15347T
Alternativnummer: MBL-CNA15347T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 87-236 of human CLIC3 (NP_004660.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 9022
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Target-Kategorie: CLIC3
Application Verdünnung: WB: WB,1:200 - 1:2000