MTMR6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15348T
Artikelname: MTMR6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15348T
Hersteller Artikelnummer: CNA15348T
Alternativnummer: MBL-CNA15348T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-621 of human MTMR6 (NP_004676.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 9107
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RCGQLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEAFLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLEDQKKYLNPLYSSESHRFTVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESKIKQRKNKQTDGILTKELLHSVHPESPNLKTSLCFKEQTLLPVNDALRTIEGSSPADNRYSEYAEEFSKSEPAVVSLEYGVARMTC
Target-Kategorie: MTMR6
Application Verdünnung: WB: WB,1:200 - 1:2000