SPPL2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15539T
Artikelname: SPPL2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15539T
Hersteller Artikelnummer: CNA15539T
Alternativnummer: MBL-CNA15539T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human SPPL2A (NP_116191.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 84888
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
Target-Kategorie: SPPL2A
Application Verdünnung: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200