FCHSD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15543T
Artikelname: FCHSD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15543T
Hersteller Artikelnummer: CNA15543T
Alternativnummer: MBL-CNA15543T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-400 of human FCHSD1 (NP_258260.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 77kDa
NCBI: 89848
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RLQASDRYRDLAGGTGRSAKEQVLRKGTENLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQEKAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLQAARNEYLLNLVATNAHLDHYYQEELPALLKALVSELSEHLRDPLTSLSHTELEAAEVILEHAHRGEQTTSQVSWEQDLKLFLQEPGVFSPTPPQQFQPAGTDQVCVLEWGAEGVAGKSGLEKEVQRLTSRAARDYKIQNHGHRVLQRL
Target-Kategorie: FCHSD1
Application Verdünnung: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200