TPD52L3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15544T
Artikelname: TPD52L3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15544T
Hersteller Artikelnummer: CNA15544T
Alternativnummer: MBL-CNA15544T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human TPD52L3 (NP_001001875.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 89882
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI
Target-Kategorie: TPD52L3
Application Verdünnung: WB: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200