GPRIN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15555T
Artikelname: GPRIN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15555T
Hersteller Artikelnummer: CNA15555T
Alternativnummer: MBL-CNA15555T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GPRIN1 (NP_443131.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 114787
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDTAEDPAWLQLLQKDSSPPGPRPTAFFCPQDGSLGAGSSAMRDYCPSQQKASPAPPRHTPDQSPGMESRHRSPSGAGEGASCSDGPRGSLACPSPTCFSPQESPSKETLEAHGASISGTPEATTSGKPEPVSSVKTEPKSSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRKADPMFTGKAEPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFP
Target-Kategorie: GPRIN1
Application Verdünnung: WB: WB,1:200 - 1:2000