FLYWCH2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15556T
Artikelname: FLYWCH2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15556T
Hersteller Artikelnummer: CNA15556T
Alternativnummer: MBL-CNA15556T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 51-140 of human FLYWCH2 (NP_612448.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 114984
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: STKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL
Target-Kategorie: FLYWCH2
Application Verdünnung: WB: WB,1:200 - 1:2000