[KO Validated] ITCH Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15612T
Artikelname: [KO Validated] ITCH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15612T
Hersteller Artikelnummer: CNA15612T
Alternativnummer: MBL-CNA15612T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-155 of ITCH (NP_001244066.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 83737
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETT
Target-Kategorie: ITCH
Application Verdünnung: WB: WB,1:500 - 1:1000