TrkA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15618S
Artikelname: TrkA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15618S
Hersteller Artikelnummer: CNA15618S
Alternativnummer: MBL-CNA15618S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human TrkA (NP_002520.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 87kDa
NCBI: 4914
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Target-Kategorie: NTRK1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200