GSTT2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15678T
Artikelname: GSTT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15678T
Hersteller Artikelnummer: CNA15678T
Alternativnummer: MBL-CNA15678T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human GSTT2 (NP_000845.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 2953
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Target-Kategorie: GSTT2
Application Verdünnung: WB: WB,1:500 - 1:2000