HNRNPD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15679P
Artikelname: HNRNPD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15679P
Hersteller Artikelnummer: CNA15679P
Alternativnummer: MBL-CNA15679P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human HNRNPD (NP_002129.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 3184
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEI
Target-Kategorie: HNRNPD
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000