IL10RB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15680T
Artikelname: IL10RB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15680T
Hersteller Artikelnummer: CNA15680T
Alternativnummer: MBL-CNA15680T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-220 of human IL10RB (NP_000619.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 3588
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS
Target-Kategorie: IL10RB
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200