NDUFA4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15693T
Artikelname: NDUFA4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15693T
Hersteller Artikelnummer: CNA15693T
Alternativnummer: MBL-CNA15693T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 9kDa
NCBI: 4697
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
Target-Kategorie: NDUFA4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:100