ORC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15697T
Artikelname: ORC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15697T
Hersteller Artikelnummer: CNA15697T
Alternativnummer: MBL-CNA15697T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 458-577 of human ORC2 (NP_006181.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 4999
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA
Target-Kategorie: ORC2
Application Verdünnung: WB: WB,1:500 - 1:2000