SERPINI1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15703T
Artikelname: SERPINI1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15703T
Hersteller Artikelnummer: CNA15703T
Alternativnummer: MBL-CNA15703T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 181-410 of human SERPINI1 (NP_005016.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 5274
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Target-Kategorie: SERPINI1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100