p90Rsk/RSK1/RPS6KA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15718T
Artikelname: p90Rsk/RSK1/RPS6KA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15718T
Hersteller Artikelnummer: CNA15718T
Alternativnummer: MBL-CNA15718T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human p90Rsk/RSK1/RPS6KA1 (NP_002944.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 6195
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
Target-Kategorie: RPS6KA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200